PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.25993s0282.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family HD-ZIP
Protein Properties Length: 313aa    MW: 34553.8 Da    PI: 8.9656
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.25993s0282.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.81.9e-18157211256
                           T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
              Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                           rk+ +++keq  +Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  Bostr.25993s0282.1.p 157 RKKLRLSKEQALILEETFKEHSTLNPKQKLALAKQLNLRARQVEVWFQNRRARTK 211
                           788899***********************************************98 PP

2HD-ZIP_I/II123.41.1e-39157246191
           HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                           +kk+rlskeq+ +LEe+F+e+++L+p++K +la++L+l++rqv+vWFqnrRARtk+kq+E+d+e+Lkr++d+l+een+rL+kev+eLr 
  Bostr.25993s0282.1.p 157 RKKLRLSKEQALILEETFKEHSTLNPKQKLALAKQLNLRARQVEVWFQNRRARTKLKQTEVDCEYLKRCCDNLTEENRRLQKEVSELR- 244
                           69*************************************************************************************9. PP

           HD-ZIP_I/II  90 el 91 
                           +l
  Bostr.25993s0282.1.p 245 AL 246
                           55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046184.0E-361122IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.601.1E-18136211IPR009057Homeodomain-like
SuperFamilySSF466891.88E-18146214IPR009057Homeodomain-like
PROSITE profilePS5007117.2153213IPR001356Homeobox domain
SMARTSM003896.1E-15155217IPR001356Homeobox domain
PfamPF000466.1E-16157211IPR001356Homeobox domain
CDDcd000862.42E-14157214No hitNo description
PROSITE patternPS000270188211IPR017970Homeobox, conserved site
SMARTSM003402.9E-26213256IPR003106Leucine zipper, homeobox-associated
PfamPF021831.6E-11213247IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009641Biological Processshade avoidance
GO:0009725Biological Processresponse to hormone
GO:0010218Biological Processresponse to far red light
GO:0005634Cellular Componentnucleus
GO:0009506Cellular Componentplasmodesma
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MGERDDGLGL SLTLGISQQK EPSLRLNLMP FTTSTSSFPH MHNQNNNCHP QKIHHNSWTH  60
LFQSSGIKRT TAERNSDAGS FLRGIDVNRA PSSVAVVNME EEAAVVSSPN STVSSLSGNK  120
RDLAAARGGD EHEAERASCS RDGESDDEDC GNGDGSRKKL RLSKEQALIL EETFKEHSTL  180
NPKQKLALAK QLNLRARQVE VWFQNRRART KLKQTEVDCE YLKRCCDNLT EENRRLQKEV  240
SELRALKLSP HLYMHMTPPT TLTMCPSCER VSSSSSATVT AAPPPPAAVV GRPSPQRATP  300
WTAISLQRRS GR*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1155161SRKKLRL
2205213RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4935890.0AB493589.1 Arabidopsis thaliana At2g44910 mRNA for hypothetical protein, partial cds, clone: RAAt2g44910.
GenBankAJ4412510.0AJ441251.1 Arabidopsis thaliana mRNA for homeodomain-leucine zipper protein ATHB4 (Athb4 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010506430.10.0PREDICTED: homeobox-leucine zipper protein ATHB-4-like isoform X1
SwissprotP929530.0ATHB4_ARATH; Homeobox-leucine zipper protein ATHB-4
TrEMBLR0FX190.0R0FX19_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.4__2679__AT2G44910.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM25772772
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G44910.11e-141homeobox-leucine zipper protein 4